PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023273m
Common NameCARUB_v10023273mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 427aa    MW: 46772.7 Da    PI: 9.7192
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023273mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.7e-32162218360
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkversa +++v ei+Y+geHnh+k
  Carubv10023273m 162 DGYNWRKYGQKQVKGSECPRSYYKCTHPKCPVKKKVERSA-EGQVSEIVYQGEHNHSK 218
                      9***************************************.***************85 PP

2WRKY1031.6e-32349406259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dg++WrKYGqK+v g+ +prsYYrCtsa+C+++k+ver+++dp+++++tYeg+Hnh+
  Carubv10023273m 349 EDGFRWRKYGQKVVGGNAYPRSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHH 406
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-28158219IPR003657WRKY domain
SMARTSM007743.9E-34160218IPR003657WRKY domain
SuperFamilySSF1182901.29E-24161219IPR003657WRKY domain
PROSITE profilePS5081122.905162219IPR003657WRKY domain
PfamPF031064.5E-25162216IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.6E-32338406IPR003657WRKY domain
PROSITE profilePS5081131.766343408IPR003657WRKY domain
SuperFamilySSF1182903.66E-27344406IPR003657WRKY domain
SMARTSM007743.9E-38348407IPR003657WRKY domain
PfamPF031066.9E-26349406IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEGERVVIAK PVASRPSSSS SFRTFTELLT DTVTVSPQSN CHDIVDAAIR PKTLRFNQPV  60
AASVSCPRVE GNSNGNGKSC DDSDSRSYVV YKPKAKLVSK ATVSALANML QGNRQQIWRQ  120
TEAVGYGKSV SQGTYRAGPN PIQKVPSFSE SESSIGDRSS VDGYNWRKYG QKQVKGSECP  180
RSYYKCTHPK CPVKKKVERS AEGQVSEIVY QGEHNHSKPS CPLPRRASSS TSSGFQKPPK  240
GLASEGSMGQ DHNNNLYRPL WSNQSNDSSK TRTEKMNEGC VITPFEFAVP RSTNSNAGTS  300
DSGCRSSQCD EGSIGGELDD PNRTKRRKNE KQSSEAGVSQ GSVESDSLED GFRWRKYGQK  360
VVGGNAYPRS YYRCTSANCR ARKHVERASD DPRAFITTYE GKHNHHLILN PPASSTLPFN  420
SQQLSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-28162407378Probable WRKY transcription factor 4
2lex_A2e-28162407378Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2896070.0AB289607.1 Arabidopsis thaliana TTG2 mRNA for WRKY transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294277.10.0hypothetical protein CARUB_v10023273mg
SwissprotQ9ZUU00.0WRK44_ARATH; WRKY transcription factor 44
TrEMBLR0HPG30.0R0HPG3_9BRAS; Uncharacterized protein
STRINGAT2G37260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.10.0WRKY family protein